DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and F52E1.2

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_505170.2 Gene:F52E1.2 / 186111 WormBaseID:WBGene00018692 Length:204 Species:Caenorhabditis elegans


Alignment Length:138 Identity:35/138 - (25%)
Similarity:56/138 - (40%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GFEQIGSKYYYIEKV-SEKNWSTASKTCRNMGGHLADIK--DEADLAAIK------ANLKEDTHY 193
            |::.:.||.|  :|. :...::.|:..|...|..|..|.  ||.|  |::      |.:.|....
 Worm    69 GWQYLNSKCY--KKFDAAVTYAGATSACAAQGAELVTIDSFDEND--ALRKAFDTNALVDETKET 129

  Fly   194 WLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ--------LDTL-NCVFLY-NGEMYDYPCHY 248
            |:|:..|....::..   |...|:..||..:||.        .|:| |..:.| .|....|.|..
 Worm   130 WIGLKSLSGAWQWAD---GSSATYTNWAPSQPSSNGLCVQMITDSLSNATYKYQRGGWKTYGCGK 191

  Fly   249 T-FRFICQ 255
            | ..:||:
 Worm   192 TSASYICE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/128 (24%)
F52E1.2NP_505170.2 CLECT 66..199 CDD:214480 34/136 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.