DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and clec-45

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_504977.1 Gene:clec-45 / 184130 WormBaseID:WBGene00017199 Length:155 Species:Caenorhabditis elegans


Alignment Length:111 Identity:28/111 - (25%)
Similarity:48/111 - (43%) Gaps:23/111 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VSEKNWSTASKTCRNMGGHLADIKDEADLAAIKAN----------LKEDTHYWLGINDLDHEGKF 206
            |:..::|.||..|:::|..:..|::     ||:.|          ...|..||||:.........
 Worm    40 VAPLSYSDASAKCKSLGAKVLTIQN-----AIQNNAVLSFATASATGNDKDYWLGLQCTTASSSS 99

  Fly   207 LSMPTGKQTTFLKWASGRP-SQLDTLNCVFLYN-----GEMYDYPC 246
            .:...|.:.:|..:|.|:| :.|.|  |||:.|     |:.:...|
 Worm   100 CNWADGSKFSFDGFAEGQPNNSLGT--CVFVGNRGQTAGQWFSAEC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 28/111 (25%)
clec-45NP_504977.1 CLECT 22..153 CDD:214480 28/111 (25%)

Return to query results.
Submit another query.