DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and clec-178

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_500843.1 Gene:clec-178 / 177344 WormBaseID:WBGene00020585 Length:178 Species:Caenorhabditis elegans


Alignment Length:225 Identity:53/225 - (23%)
Similarity:86/225 - (38%) Gaps:67/225 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LGVLTPVLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNE 106
            |.:|.|.:|.:.|...|.:|..|            :.||..          :.||...|.|.|  
 Worm     6 LYLLIPTINTVVIPSPLKSSYQS------------IAGQRA----------INLDVNVRLLTV-- 46

  Fly   107 QNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYY--YIEKVSEKN--WSTASKTCRNM 167
                                          |..:|.|.:.|  :..|:.|.:  |..|...||:|
 Worm    47 ------------------------------LALQQSGWQLYEDHWYKMFETDVMWIPAENVCRSM 81

  Fly   168 GGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLN 232
            ||||..||||::...:. .|::..:.|:|:|.|:..........|.:..:|.|||.:|::.| ::
 Worm    82 GGHLVSIKDESENLFVH-KLRKKNNIWIGLNKLNDTFHVYKWSDGSEADYLNWASSQPNEPD-VD 144

  Fly   233 CVFL-----YNGEMYDYPCHYTFR--FICQ 255
            |.::     ..|..:||.|.....  |:|:
 Worm   145 CAYMAFHQEQRGTWFDYGCREMLPQFFVCK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 34/119 (29%)
clec-178NP_500843.1 CLECT 52..174 CDD:214480 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 1 1.000 - - X29
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.