DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and clec-150

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_497312.1 Gene:clec-150 / 175261 WormBaseID:WBGene00019914 Length:362 Species:Caenorhabditis elegans


Alignment Length:93 Identity:24/93 - (25%)
Similarity:43/93 - (46%) Gaps:10/93 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GFEQI--GSKYYYIEKVSEKNWSTASKTCRNMGG-HLADIKDEADLAAIKANLKEDT-----HYW 194
            |.|::  ..|:.|:......::..|.|.|.:.|| |||.:....|...: .||..::     ::|
 Worm    27 GEEKLDPSGKFCYVVHTGAASFHDAEKACYDYGGYHLASVPSMIDNNFL-YNLSSNSNVWANYFW 90

  Fly   195 LGINDLDHEGKFLSMPTGKQTTFLKWAS 222
            :|:.|:..:|.: ....|....|:.|||
 Worm    91 IGLTDMTADGSW-EWIDGLDLVFMNWAS 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 21/83 (25%)
clec-150NP_497312.1 CLECT 33..147 CDD:214480 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.