DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Mbl2

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:138 Identity:38/138 - (27%)
Similarity:68/138 - (49%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIK 184
            ::||...:..::..:.:...|::|.| |::..|.:.:.......|....|.:|..::..:.:||:
Mouse   108 IAALRSELRALRNWVLFSLSEKVGKK-YFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQ 171

  Fly   185 ANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQL-DTLNC-VFLYNGEMYDYPCH 247
             .:.:|..| |||.|:..||.|..: ||.:..:..|..|.|:.. |..:| |.|.||:..|.||.
Mouse   172 -KVAKDIAY-LGITDVRVEGSFEDL-TGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCS 233

  Fly   248 YTFRFICQ 255
            .:|..||:
Mouse   234 DSFLAICE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 32/110 (29%)
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101
CLECT 132..242 CDD:382969 34/114 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.