DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Mbl2

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_034906.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:138 Identity:38/138 - (27%)
Similarity:68/138 - (49%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIK 184
            ::||...:..::..:.:...|::|.| |::..|.:.:.......|....|.:|..::..:.:||:
Mouse   108 IAALRSELRALRNWVLFSLSEKVGKK-YFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQ 171

  Fly   185 ANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQL-DTLNC-VFLYNGEMYDYPCH 247
             .:.:|..| |||.|:..||.|..: ||.:..:..|..|.|:.. |..:| |.|.||:..|.||.
Mouse   172 -KVAKDIAY-LGITDVRVEGSFEDL-TGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCS 233

  Fly   248 YTFRFICQ 255
            .:|..||:
Mouse   234 DSFLAICE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 32/110 (29%)
Mbl2NP_034906.1 Collagen 36..93 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101
CLECT 132..242 CDD:470576 34/114 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.