DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Mbl1

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_034905.1 Gene:Mbl1 / 17194 MGIID:96923 Length:239 Species:Mus musculus


Alignment Length:155 Identity:37/155 - (23%)
Similarity:64/155 - (41%) Gaps:22/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIK 175
            |:|..||..:..| |:.|::..|:......:...|..::....:..:|.....|..:.|      
Mouse    94 EKLANMEAEIRIL-KSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQG------ 151

  Fly   176 DEADLAAIKANLKEDTHY--------WLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDT-L 231
                ..||..|.:|:...        :|||.|...||:|:.: ||.:.|:..|....|:...: .
Mouse   152 ----TVAIPRNAEENKAIQEVATGIAFLGITDEATEGQFMYV-TGGRLTYSNWKKDEPNNHGSGE 211

  Fly   232 NCV-FLYNGEMYDYPCHYTFRFICQ 255
            :|| .|.||...|..|..:|:.:|:
Mouse   212 DCVIILDNGLWNDISCQASFKAVCE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 27/118 (23%)
Mbl1NP_034905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..88
Collagen <37..89 CDD:189968
CLECT_collectin_like 127..237 CDD:153061 29/121 (24%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000250|UniProtKB:P19999 203..211 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.