DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Fcer2

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001029096.1 Gene:Fcer2 / 171075 RGDID:619997 Length:331 Species:Rattus norvegicus


Alignment Length:295 Identity:76/295 - (25%)
Similarity:120/295 - (40%) Gaps:67/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SALLCGLLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSSKANEV 70
            :.:..|||||.|...|.....:..|.|...|           .::|:|.......||..::.::.
  Rat    34 TVMWAGLLALLLLWHWETEKSLKQLGDAAIQ-----------NVSHVTKDLQNYQSNQLAQKSQA 87

  Fly    71 LVRQYTMEGQLTALQNKQLSIEVAL-----DAQGRKLNVNEQN--FTERLNCMEGIL-------- 120
            |.....:| :|.|.|.:..|.:..|     :.|...:||..||  .::.||.::..|        
  Rat    88 LQMSQNLE-ELQAEQKQMKSQDSQLSQNLNELQEDLINVKSQNSELSQNLNTLQEDLVNVKSQGL 151

  Fly   121 -------SALEKTVLEV-KTKIK---------------YLGFEQIGSKYYYIEKVSEKNWSTASK 162
                   .:|||...|| |..|:               :|.|:|   |.||..:.| |.|..|..
  Rat   152 NEKRAASDSLEKLQEEVAKLWIEILMSKGTACNVCPKDWLHFQQ---KCYYFGEGS-KQWIQAKF 212

  Fly   163 TCRNMGGHLADI--KDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRP 225
            ||.::.|.|..|  :.|.|......|.||.   |:|:.||:.||:|: .|.|....:..|:.|.|
  Rat   213 TCSDLEGRLVSIHSQKEQDFLMQHINKKES---WIGLQDLNMEGEFV-WPDGSPVGYSNWSPGEP 273

  Fly   226 S---QLDTLNCVFLY-NGEMYDYPCH-YTFRFICQ 255
            :   |.:  :||.:. :|:..|..|. |...::|:
  Rat   274 NNGGQGE--DCVMMRGSGQWNDAFCRSYLDAWVCE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 35/115 (30%)
Fcer2NP_001029096.1 RILP-like <60..170 CDD:304877 26/121 (21%)
CLECT_DC-SIGN_like 186..306 CDD:153060 39/129 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.