DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Cd209d

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_570974.1 Gene:Cd209d / 170779 MGIID:2157947 Length:237 Species:Mus musculus


Alignment Length:121 Identity:27/121 - (22%)
Similarity:53/121 - (43%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHE---- 203
            ||.|::.:  |::||..::..|:.:|..|..|:.:.:...::...|.....|:|::|:.:|    
Mouse   115 GSCYFFSK--SQRNWHNSTTACQELGAQLVIIETDEEQTFLQQTSKARGPTWMGLSDMHNEATWH 177

  Fly   204 ---GKFLSMPTGKQTTFLK-WASGRPSQLDTLNCVFLYNGEMYDYPCHYTFRFICQ 255
               |..||      .:|.: |..|.|:.:...:|.........|..|.....:||:
Mouse   178 WVDGSPLS------PSFTRYWNRGEPNNVGDEDCAEFSGDGWNDLSCDKLLFWICK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 24/116 (21%)
Cd209dNP_570974.1 CLECT_DC-SIGN_like 106..228 CDD:153060 27/121 (22%)

Return to query results.
Submit another query.