DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Cd209c

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_017168078.1 Gene:Cd209c / 170776 MGIID:2157945 Length:240 Species:Mus musculus


Alignment Length:140 Identity:34/140 - (24%)
Similarity:63/140 - (45%) Gaps:11/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 KTVLEVKTKIKYL------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAI 183
            |.:.::|::|..|      .:.......|:..|. ::||:.:...||.:...|..||.:.:.:.:
Mouse    94 KEMTQLKSQINRLCRPCPWDWTVFQGNCYFFSKF-QQNWNDSVNACRKLDAQLVVIKSDDEQSFL 157

  Fly   184 KANLKEDTHYWLGINDLDHEGKFLSMPTGKQT--TFLK-WASGRPSQLDTLNCVFLYNGEMYDYP 245
            :...||..:.|:|::||.|||:: ....|...  :|:| |..|.|:.....:|.........|.|
Mouse   158 QQTSKEKGYAWMGLSDLKHEGRW-HWVDGSHLLFSFMKYWNKGEPNNEWEEDCAEFRGDGWNDAP 221

  Fly   246 CHYTFRFICQ 255
            |.....:||:
Mouse   222 CTIKKYWICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 29/111 (26%)
Cd209cXP_017168078.1 CLECT_DC-SIGN_like 110..232 CDD:153060 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.