DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CG43797

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001260012.1 Gene:CG43797 / 14462692 FlyBaseID:FBgn0264341 Length:232 Species:Drosophila melanogaster


Alignment Length:261 Identity:71/261 - (27%)
Similarity:124/261 - (47%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSASALLCGLLALNLYGAWA---ESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSN 62
            |.|..:...|.::..:.||..:   |.|..|.|.|.|:|||.||:....|:..|..|.||     
  Fly     1 MFKLGTYYFCIIVTFHAYGIVSPQDEKDSECVLTDAPNQCGAFCMSAQRPLFEHNRIIQN----- 60

  Fly    63 NSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTV 127
               :..|:...|.....:|..::|:.:::::  :.:..|..:||.:.|:    :|||.:.....:
  Fly    61 ---QIYEISSLQAESHERLKRIENELINLQI--EQKESKQAINENDDTK----VEGIETTTSVNL 116

  Fly   128 LEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTH 192
            ::.|             ||..::|.  .||..|.|.|:.:||.||:..||.:...:.:.::.||.
  Fly   117 IKKK-------------KYVIVDKA--LNWYNAVKFCQEIGGKLAEFSDEHEYDTVISTVEPDTC 166

  Fly   193 YWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ--LDTLNCVFLYNGEMYDYPCHYTFRFICQ 255
            ||:||...::|.:  |:.|..:..:||.|. .|:.  .:..|||.:.||.|:|..|:.::..||.
  Fly   167 YWIGIRSYNNEHQ--SLRTDNRPLYLKMAD-MPNNNIFNGENCVGIQNGFMHDLWCNLSYYSICT 228

  Fly   256 T 256
            |
  Fly   229 T 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 35/110 (32%)
CG43797NP_001260012.1 CLECT 122..227 CDD:153057 34/109 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.