DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Fcer2a

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:304 Identity:74/304 - (24%)
Similarity:117/304 - (38%) Gaps:83/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASALLCGLLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSSKANE 69
            ::|:..|||||.|...|.....:..|.|...|           .::|:|.......||..::.::
Mouse    37 STAMWAGLLALLLLWHWETEKNLKQLGDTAIQ-----------NVSHVTKDLQKFQSNQLAQKSQ 90

  Fly    70 VLVRQYTMEGQLTALQNKQLSIEVALDAQGRKL------------NVNEQN--FTERLNCMEGIL 120
            |:    .|...|..||.:|..::    ||..:|            |...||  .::.||.::..|
Mouse    91 VV----QMSQNLQELQAEQKQMK----AQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDL 147

  Fly   121 ---------------SALEKTVLEVKTKI-----------------KYLGFEQIGSKYYYIEKVS 153
                           .:|||...|| .|:                 .:|.|:|   |.||..|.|
Mouse   148 VNIKSLGLNEKRTASDSLEKLQEEV-AKLWIEILISKGTACNICPKNWLHFQQ---KCYYFGKGS 208

  Fly   154 EKNWSTASKTCRNMGGHLADI--KDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTT 216
             |.|..|...|.::.|.|..|  :.|.|......|.|:.   |:|:.||:.||:|: ...|....
Mouse   209 -KQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDS---WIGLQDLNMEGEFV-WSDGSPVG 268

  Fly   217 FLKWASGRPS---QLDTLNCVFLY-NGEMYDYPCH-YTFRFICQ 255
            :..|..|.|:   |.:  :||.:. :|:..|..|. |...::|:
Mouse   269 YSNWNPGEPNNGGQGE--DCVMMRGSGQWNDAFCRSYLDAWVCE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 33/115 (29%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056 22/106 (21%)
CLECT_DC-SIGN_like 190..310 CDD:153060 37/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.