DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CG43055

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:158 Identity:38/158 - (24%)
Similarity:60/158 - (37%) Gaps:29/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 MEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADL 180
            :||:.|.|......         |.:||..||:||...::||..|.:.||.|...|...:|..:.
  Fly    28 IEGVASYLNTPTAP---------FVKIGDSYYFIENKLDRNWYDAFEACRQMNADLVAFEDRKEQ 83

  Fly   181 AAIKANLKE---DTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQL-DTLNCVFLYNGE- 240
            ..|...|.:   ||.||....||..:..|:....|:......|.:..|:.. :..:||     | 
  Fly    84 KLIYHYLVDNEMDTTYWTAGTDLAEQDSFVWFSNGQPVASDLWCNNEPNNAKNEEHCV-----EY 143

  Fly   241 ----------MYDYPCHYTFRFICQTEE 258
                      :.|..|.:...:||:..:
  Fly   144 KPLHPEAKMGLNDRVCTFKTGYICRAPQ 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 30/123 (24%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.