DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and vcana

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021331663.1 Gene:vcana / 116993 ZFINID:ZDB-GENE-011023-1 Length:8936 Species:Danio rerio


Alignment Length:157 Identity:43/157 - (27%)
Similarity:68/157 - (43%) Gaps:24/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 CMEGI-------LSALEKTVLEVKTKIKYLGFEQI-GSKYYYIEKVSEKNWSTASKTCRNMGGHL 171
            |::|:       |.:....:.|..|:....|:.:. |..|.|..  ..:||.||.:.||..|.||
Zfish  8671 CIDGLNSFTCLCLPSYAGALCEQDTETCSYGWHKFQGHCYKYFP--HRRNWDTAERECRLQGAHL 8733

  Fly   172 ADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTL----- 231
            |.:....:...|. .|..| :.|:|:||...|..| ....|:...:..|   ||:|.|:.     
Zfish  8734 ASVLSHDEQQYIN-RLGHD-YQWIGLNDKMFENDF-RWTDGRVVQYENW---RPNQPDSFFSSGE 8792

  Fly   232 NCVFLY---NGEMYDYPCHYTFRFICQ 255
            :||.:.   :|:..|.||:|...|.|:
Zfish  8793 DCVVMIWHEDGQWNDVPCNYHLTFTCK 8819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 35/116 (30%)
vcanaXP_021331663.1 Ig 31..149 CDD:472250
Ig strand B 40..44 CDD:409482
Ig strand C 66..70 CDD:409482
Ig strand E 110..114 CDD:409482
Ig strand F 124..129 CDD:409482
Ig strand G 142..145 CDD:409482
Link_domain_CSPGs_modules_1_3 147..241 CDD:239594
Link_domain_CSPGs_modules_2_4 249..343 CDD:239597
Herpes_BLLF1 <5897..>6290 CDD:282904
MSCRAMM_ClfA <8105..8452 CDD:468110
EGF 8622..8652 CDD:394967
EGF_CA 8656..8692 CDD:238011 3/20 (15%)
CLECT_CSPGs 8698..8821 CDD:153058 38/130 (29%)
CCP 8825..8881 CDD:153056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.