DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4f

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:262 Identity:48/262 - (18%)
Similarity:94/262 - (35%) Gaps:66/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVA------------------LDAQG 99
            |::..:.|:|...:..:..::  .::.||.:..:....|||.                  .|...
  Rat   283 TLTAQIQNANGHLEQTDTQIQ--GLKAQLKSTSSLNSQIEVVNGKLKDSSRELQTLRRDLSDVSA 345

  Fly   100 RKLNVN----------------------EQNFTERLNCMEGILSALEKTVLE----VKTKIKYL- 137
            .|.||.                      .:....::...:..|.||:|.|..    .||:.:.| 
  Rat   346 LKSNVQMLQSNLQKAKAEVQSLKTGLEATKTLAAKIQGQQSDLEALQKAVAAHTQGQKTQNQVLQ 410

  Fly   138 ----GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGIN 198
                .::....|:||..: .:|:|..|...|.:.|.|||.:..:.:.|.: ..:.....:|:|:.
  Rat   411 LIMQDWKYFNGKFYYFSR-DKKSWHEAENFCVSQGAHLASVTSQEEQAFL-VQITNAVDHWIGLT 473

  Fly   199 DLDHEGKFLSMPTGKQTTFLK----WASGRPSQL-----DTLNCVFLYNGEMY-DYPCHYTFRFI 253
            |...||.: ....|....:::    |..|:|...     :..:||.|.  .|: |..|...:.::
  Rat   474 DQGTEGNW-RWVDGTPFDYVQSRRFWRKGQPDNWRHGNGEREDCVHLQ--RMWNDMACGTAYNWV 535

  Fly   254 CQ 255
            |:
  Rat   536 CK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 26/118 (22%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008 13/108 (12%)
CLECT_DC-SIGN_like 414..538 CDD:153060 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.