DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and COLEC10

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_006429.2 Gene:COLEC10 / 10584 HGNCID:2220 Length:277 Species:Homo sapiens


Alignment Length:142 Identity:43/142 - (30%)
Similarity:70/142 - (49%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LEKTVLEVKTKIKYL-----GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAA 182
            |:.::..:||.:|::     |..:...|:|||.: .|||:..:...||..||.||..||||....
Human   131 LDISIARLKTSMKFVKNVIAGIRETEEKFYYIVQ-EEKNYRESLTHCRIRGGMLAMPKDEAANTL 194

  Fly   183 IKANLKEDTHY--WLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCV-FLYNGEMYD 243
            |...:.:...:  ::|:|||:.||:::.........:..|..|.||. ....:|| .|.:|...|
Human   195 IADYVAKSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPSDPYGHEDCVEMLSSGRWND 259

  Fly   244 YPCHYTFRFICQ 255
            ..||.|..|:|:
Human   260 TECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 36/112 (32%)
COLEC10NP_006429.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..107
Collagen 45..111 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 38/116 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10327
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41772
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.