DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CLEC4M

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:155 Identity:31/155 - (20%)
Similarity:53/155 - (34%) Gaps:52/155 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LPTSLPLGMAIGAVLEREDPRDALV-------------LNERHRGCTLATLPRGSIVGTSSLR-- 142
            :|...|.|..:..||:::..:::.:             :|........|.|.|.....|..|:  
Human     1 MPPQSPGGSGMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTH 65

  Fly   143 ---RSAQLA-----------------------RYYSHLAVCDIRGNLNTRLAKLDAEASKFAGII 181
               |:||||                       :||| :.|..:.....|.|.:|.|..::.||  
Human    66 VKARTAQLAKIKWVISVAFYVLQAALMISLIWKYYS-VPVAVVPSKWITPLDRLVAFPTRVAG-- 127

  Fly   182 LAQAGLVRMGW----NKRIDQIIEP 202
                |:....|    ||.:..::.|
Human   128 ----GVGITCWILVCNKVVAIVLHP 148

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 18/84 (21%)