DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and zmp:0000000937

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021327947.1 Gene:zmp:0000000937 / 101884588 ZFINID:ZDB-GENE-130530-940 Length:290 Species:Danio rerio


Alignment Length:245 Identity:65/245 - (26%)
Similarity:106/245 - (43%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CLGVLTPVLNHLTISQNLANSNNSSKANEVLVRQ-YTMEGQLTALQNKQLSIEVALDAQGRKLNV 104
            ||.:||.|:    :......:||::.|.|  .|| .|....:|..::|.|:..:.|.....|:.:
Zfish    51 CLLLLTAVI----VLSVFIYTNNTNFAEE--RRQLITNIANITEDRDKLLTDIINLTKIKDKVLI 109

  Fly   105 N----EQNFTERLNCMEGILSA----LEKTVLEVKTK---IKYL---GFE-QIGSKYYYIEKVSE 154
            |    |::..|.||.:.....|    |:|....:|.|   ||.|   |.| ...|.:||:.. ..
Zfish   110 NITNLEEDRDELLNKITTFTKARNEILKKNANLLKDKDQLIKQLQVFGQEAYYQSSFYYLSS-ER 173

  Fly   155 KNWSTASKTCRNMGGHLADI--KDEADLAAIKANLKEDTHYWLGINDLDHEG--KFLSMPTGKQT 215
            |:|:.:.:.|::.|..|..|  |.|.|..   ..:..:..:|:|:.|.|.||  |::.   |...
Zfish   174 KSWTESRRDCKDRGADLIIINNKQEQDFI---MKITSNNEFWIGLTDSDKEGIWKWVD---GSNL 232

  Fly   216 TFLKWASG----RPSQLDTLNCVFLY---NGEM---YDYPCHYTFRFICQ 255
            |...|||.    .|:...|.||...:   :.|:   .|..|...:::||:
Zfish   233 TSRFWASSGSITEPNGRKTENCAVTHLKKHPELIGWLDVACDGAYQWICE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/122 (25%)
zmp:0000000937XP_021327947.1 CLECT_DC-SIGN_like 161..283 CDD:153060 33/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.