DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and LOC101884413

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021327946.1 Gene:LOC101884413 / 101884413 -ID:- Length:292 Species:Danio rerio


Alignment Length:233 Identity:62/233 - (26%)
Similarity:108/233 - (46%) Gaps:38/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FCLGVLTPVLNHLTISQN----------LANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVA 94
            |.|..:..||:.:..:.|          |.|..|.::..:.|:.:.|   .||..||:..:..:.
Zfish    76 FLLLTVVMVLSVIIYTNNTNYTEERHQLLTNITNLTEDRDTLLTKIT---NLTEDQNQLHAKNIR 137

  Fly    95 LDAQGRKLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWST 159
            |..:..:|..|||:..::.:.:.     .||..|   .|::::.:.   |..||..|: :|:|:.
Zfish   138 LTQEKDELLSNEQDLIKQRDHLN-----QEKNEL---LKMEWIYYR---SNLYYFFKL-KKSWTE 190

  Fly   160 ASKTCRNMGGHLADI--KDEADLA-AIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWA 221
            :.:.|||.|..|..|  ::|.|.. .|.|..|.    |:|::|.|.||.:..:...|.|::: |.
Zfish   191 SRRYCRNHGADLVIINNREEQDFVDKITAGEKA----WIGLSDSDVEGSWKWVDDSKPTSWI-WH 250

  Fly   222 SGRPS----QLDTLNCVFLYNGEMYDYPCHYTFRFICQ 255
            .|.||    |::. :||........||||...|::||:
Zfish   251 YGEPSSGGGQVEE-DCVLTVTSAWADYPCDAEFQWICE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 37/115 (32%)
LOC101884413XP_021327946.1 SH3_and_anchor <97..174 CDD:275056 18/87 (21%)
CLECT_DC-SIGN_like 170..288 CDD:153060 39/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.