Sequence 1: | NP_001137766.1 | Gene: | lectin-22C / 7354375 | FlyBaseID: | FBgn0259230 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335897.1 | Gene: | si:dkey-187i8.2 / 101882603 | ZFINID: | ZDB-GENE-121214-181 | Length: | 635 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 49/201 - (24%) |
---|---|---|---|
Similarity: | 83/201 - (41%) | Gaps: | 36/201 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 KANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTVLEV 130
Fly 131 KTKIKYL-GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKE----- 189
Fly 190 ----DTHYWLGINDLDHEGKFLSMPTGKQTT-FLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYT 249
Fly 250 FRFICQ 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-22C | NP_001137766.1 | CLECT | 146..255 | CDD:153057 | 33/118 (28%) |
si:dkey-187i8.2 | XP_021335897.1 | SMC_N | <113..507 | CDD:330553 | 11/63 (17%) |
CLECT_DC-SIGN_like | 515..633 | CDD:153060 | 36/129 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X29 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |