DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and si:dkey-187i8.2

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021335897.1 Gene:si:dkey-187i8.2 / 101882603 ZFINID:ZDB-GENE-121214-181 Length:635 Species:Danio rerio


Alignment Length:201 Identity:49/201 - (24%)
Similarity:83/201 - (41%) Gaps:36/201 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTVLEV 130
            |..|.|:...|   .||..:::..|..:.|..:..:|:.|..:..|:           ...:.:.
Zfish   457 KETEELIANNT---DLTKERDRLFSENIRLTKEREELSSNISDLIEQ-----------RDQLTKE 507

  Fly   131 KTKIKYL-GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKE----- 189
            ||::..: |:....|..|::..:: |:|..:.|.|...|         |||..|. |.||     
Zfish   508 KTELSNMDGWVYFQSSLYFLSSLT-KSWEESRKDCIARG---------ADLVIIN-NGKEQEMVN 561

  Fly   190 ----DTHYWLGINDLDHEGKFLSMPTGKQTT-FLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYT 249
                |...|:|:.|::.||.:..:...|||: |..|.|..|:.....|||........|:.||..
Zfish   562 MICGDVLVWIGLTDIEEEGTWKWVDGSKQTSGFRYWRSREPNGNRKENCVLTDAHGWIDHRCHEA 626

  Fly   250 FRFICQ 255
            .::||:
Zfish   627 NKWICE 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 33/118 (28%)
si:dkey-187i8.2XP_021335897.1 SMC_N <113..507 CDD:330553 11/63 (17%)
CLECT_DC-SIGN_like 515..633 CDD:153060 36/129 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.