DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and asgrl2

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_005170656.1 Gene:asgrl2 / 101882127 ZFINID:ZDB-GENE-080917-52 Length:299 Species:Danio rerio


Alignment Length:272 Identity:61/272 - (22%)
Similarity:101/272 - (37%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WAESDVICPLKDPPSQCGG---FCLGV------LTPVLNHLTISQNLANSNNSSKANEVLVRQYT 76
            |.....:..|...||  ||   :|.|:      |..:|..:|:|.|....|....|.||.::   
Zfish    34 WRGDPSVRRLAAVPS--GGRWRWCAGIAGSVAALMLLLLIITVSVNHVKFNRKFSATEVRIQ--- 93

  Fly    77 MEGQLTALQNKQLSIEVALDAQGRKLN--VNEQNFTERL------NCMEGILSALEKTVLEVKTK 133
               .||.:....:|....|:..|.|:|  |:...|.:|:      |.:|. ..||...|.|:|..
Zfish    94 ---NLTQIILNVISRTQELEQFGHKINADVSSLEFDQRMTETSMNNLLES-AQALHDKVSELKCH 154

  Fly   134 IKYL------------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKAN 186
            |..:            .:....|..|:. .....:|.:|...|......|..:..:.:.:.:.:.
Zfish   155 IDKMRNNNTQELCCPDQWSLFSSNCYFF-STDGMSWDSARDECERKRAKLLILTSKLEKSFVVSK 218

  Fly   187 LKEDTHYWLGIND-LDHEGKFLSMPTGKQTTFLKWASGRPSQLDT------LNCV-FLYNGEMYD 243
            .| ...||||:.| ...|.::|. .|..:....:|..|:|.....      .:|. |.::|...|
Zfish   219 TK-PLFYWLGLTDGRTGEWEWLD-ETPYEMVRSEWRPGQPDNWKAHGLGGGEDCAHFHHDGRYND 281

  Fly   244 YPCHYTFRFICQ 255
            ..|...:|:||:
Zfish   282 DHCSRHYRYICK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 24/116 (21%)
asgrl2XP_005170656.1 zf-C4H2 <108..>165 CDD:313386 15/57 (26%)
CLECT_DC-SIGN_like 168..293 CDD:153060 25/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.