DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CLEC3A

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_005743.5 Gene:CLEC3A / 10143 HGNCID:2052 Length:197 Species:Homo sapiens


Alignment Length:222 Identity:48/222 - (21%)
Similarity:91/222 - (40%) Gaps:45/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CLGVLTPVLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVN 105
            |:.|:|.:|:..|...:...:...||..               :::|...::..::....::|..
Human     9 CILVITLLLDQTTSHTSRLKARKHSKRR---------------VRDKDGDLKTQIEKLWTEVNAL 58

  Fly   106 EQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGH 170
            ::....:..|:.|             ||:         .|..|:.....|::..|::.|.:.||.
Human    59 KEIQALQTVCLRG-------------TKV---------HKKCYLASEGLKHFHEANEDCISKGGI 101

  Fly   171 LADIKDEADLAAI----KANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTL 231
            |...::..::.|:    |.:|.....:||||||:..||||:.: .|...:||.|...:|:.....
Human   102 LVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDV-NGIAISFLNWDRAQPNGGKRE 165

  Fly   232 NCVFL---YNGEMYDYPCHYTFRFICQ 255
            |||..   ..|:..|..|..:.|:||:
Human   166 NCVLFSQSAQGKWSDEACRSSKRYICE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 33/115 (29%)
CLEC3ANP_005743.5 CLECT_tetranectin_like 68..193 CDD:153066 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.