DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and LOC100536834

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021322025.1 Gene:LOC100536834 / 100536834 -ID:- Length:481 Species:Danio rerio


Alignment Length:148 Identity:35/148 - (23%)
Similarity:58/148 - (39%) Gaps:43/148 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLK 188
            |..|..:||         :.||.:|...:.:.||..|...||         |:..||..| :|..
Zfish   134 ELNVFYIKT---------LYSKGFYAVSIYQMNWLDAQTYCR---------KNFRDLVTI-SNSN 179

  Fly   189 ED-----------THYWLGI--NDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCVFL--- 236
            .|           :..|:|:  :..:...|:       ..:|..||:|:|:| .::.:||.:   
Zfish   180 NDKFANSMVIMSRSPAWIGLFRDSWEWSDKW-------SRSFRYWAAGQPTQSAESGDCVGMTRK 237

  Fly   237 YNGEMYDYPCHYTFRFIC 254
            .:|:...|.|.....|||
Zfish   238 NSGQWASYSCDLQQPFIC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 29/126 (23%)
LOC100536834XP_021322025.1 CLECT 23..132 CDD:321932
CLECT 146..256 CDD:321932 30/127 (24%)
CLECT 268..372 CDD:321932
CLECT 378..>460 CDD:321932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.