DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and LOC100363064

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:114 Identity:28/114 - (24%)
Similarity:54/114 - (47%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKA-NLKEDTHYWLGINDLDHEGKF 206
            ||.|.:...::  :|..::.:|:::|.||..|...|:...:|. |::::...|:|::|...||.:
  Rat   160 GSCYLFSRTLA--SWGASASSCKDLGAHLVIINSVAEQRFMKYWNVRKNQRSWIGLSDHLREGSW 222

  Fly   207 LSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYTFRFICQ 255
             .........|..|..|.|:.....:||.|:..|..|..|.....::|:
  Rat   223 -QWVDHSPLKFSFWKEGEPNNDGDEDCVELFMDEWNDNTCTQQNFWVCE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 25/109 (23%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.