DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and cd209

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001186302.2 Gene:cd209 / 100334918 ZFINID:ZDB-GENE-061207-22 Length:343 Species:Danio rerio


Alignment Length:273 Identity:69/273 - (25%)
Similarity:108/273 - (39%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLCGL-------LALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSS 65
            |||.|       |:|.:|..:.:...|..|.:...|       :||.:.|.......|..||.:.
Zfish   103 LLCSLLMTAVTVLSLYVYTNYTQETRITSLTEERDQ-------LLTNITNLTEEKAKLLASNTNL 160

  Fly    66 KA--NEVLVRQYTMEGQLTAL------QNKQLSIE-VALDAQGRKLNVNEQNFTERLNCMEGILS 121
            |.  ::.|.....|:.||..:      :|||.|.: ..|..|..:|...:::..:||:..:    
Zfish   161 KVEKDQQLKMMKAMKDQLENIIKNLLKENKQFSSKNEDLLKQSAQLKKEKKDLEKRLHEQD---- 221

  Fly   122 ALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKAN 186
                         .:..|:   |.:|:|.. .|:||:.:.:.||:.|         |||..|. |
Zfish   222 -------------SWFYFQ---SSFYFISS-EERNWTESRRYCRDKG---------ADLIIIN-N 259

  Fly   187 LKEDTH---------YWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMY 242
            .:|..|         .|:|:.|.|...|::. .|...|.|..|..|.|:.....|||...:....
Zfish   260 REEQDHVKKMSGGFTVWIGLTDSDDRWKWID-GTNMTTGFRFWNHGEPNGQGGENCVTSRSSGWA 323

  Fly   243 DYPCHYTFRFICQ 255
            ||||.|.|.:||:
Zfish   324 DYPCFYPFPWICE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 36/117 (31%)
cd209NP_001186302.2 DivIC 94..183 CDD:299713 21/86 (24%)
CLECT_DC-SIGN_like 220..337 CDD:153060 39/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.