DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and dcsignlg

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002660626.3 Gene:dcsignlg / 100320246 ZFINID:ZDB-GENE-090313-154 Length:263 Species:Danio rerio


Alignment Length:242 Identity:55/242 - (22%)
Similarity:98/242 - (40%) Gaps:65/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLCGLLALNL----YGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSSKAN 68
            |:|.||.|.:    ....||.|:....|:...:            ||| ||| :|.:.|...:.:
Zfish    47 LICALLLLFITLQNISITAERDLFKTYKNTVEE------------LNH-TIS-SLQHDNTDLETD 97

  Fly    69 EVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTVLEVKTK 133
                 :..:|.:..:|..|:..:|...::    |::.:|.       :|..:::|...:.|.::|
Zfish    98 -----KQQLEDKYNSLSLKKQQLETKYNS----LSLGKQQ-------LENRVTSLSAELKEARSK 146

  Fly   134 IKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGIN 198
                      |.:::: .....:||.:.:.||:.|..|..||.|.....|.:.:||||  |:|::
Zfish   147 ----------SGWFFM-STEAMSWSESRQFCRDRGADLVIIKSEEKQRFISSLVKEDT--WIGLS 198

  Fly   199 DLDHEG-KFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDY 244
            ..:..| |:            ||....|     ||..|...||..:|
Zfish   199 VTETGGNKW------------KWVDNSP-----LNQGFWAKGEPNNY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 27/100 (27%)
dcsignlgXP_002660626.3 IncA <40..>144 CDD:282066 26/126 (21%)
Uso1_p115_C 78..>146 CDD:282695 17/97 (18%)
CLECT_DC-SIGN_like 144..263 CDD:153060 29/115 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.