Sequence 1: | NP_001137766.1 | Gene: | lectin-22C / 7354375 | FlyBaseID: | FBgn0259230 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001337068.6 | Gene: | si:dkey-11o15.5 / 100149199 | ZFINID: | ZDB-GENE-091204-172 | Length: | 1052 | Species: | Danio rerio |
Alignment Length: | 254 | Identity: | 57/254 - (22%) |
---|---|---|---|
Similarity: | 94/254 - (37%) | Gaps: | 71/254 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 LNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDA---------------- 97
Fly 98 ---------------QGRK-----LNVNEQNFTERLNCM---EGI------LSALEKTVLEVKTK 133
Fly 134 IKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHY--WLG 196
Fly 197 INDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCV-FLYNGEMYDYPCHYTFRFIC 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-22C | NP_001137766.1 | CLECT | 146..255 | CDD:153057 | 31/112 (28%) |
si:dkey-11o15.5 | XP_001337068.6 | CLECT | 19..136 | CDD:321932 | 22/131 (17%) |
CLECT | 143..249 | CDD:321932 | 31/114 (27%) | ||
CLECT | 257..374 | CDD:321932 | |||
CLECT | 381..498 | CDD:321932 | |||
CLECT | 509..624 | CDD:321932 | |||
CLECT | 633..739 | CDD:321932 | |||
CLECT | 746..863 | CDD:321932 | |||
CLECT | 870..996 | CDD:321932 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |