DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and si:dkey-11o15.5

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_001337068.6 Gene:si:dkey-11o15.5 / 100149199 ZFINID:ZDB-GENE-091204-172 Length:1052 Species:Danio rerio


Alignment Length:254 Identity:57/254 - (22%)
Similarity:94/254 - (37%) Gaps:71/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDA---------------- 97
            |.::.::|    |...::|......:||   .|..::|||.:|:: ||.                
Zfish    18 LQYVFVNQ----SKTWAEAQRYCRDKYT---DLATIENKQQTIQL-LDTVNDDSIDLAWIGLYDD 74

  Fly    98 ---------------QGRK-----LNVNEQNFTERLNCM---EGI------LSALEKTVLEVKTK 133
                           .|.|     .|.:..|:..:..|:   .||      .:.|..||.     
Zfish    75 LNSWKWTLEDSDFFKAGEKDFRNWYNPDPYNYGAQSLCVYVYNGIWYPASCFNTLYTTVC----- 134

  Fly   134 IKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHY--WLG 196
              |.|.|...:.|..|  ...|||:.|...||.....|..|::|.:....:..:|..::|  |:|
Zfish   135 --YDGRENASATYVVI--YQHKNWTEAQSYCREHHTDLISIRNETESQKFEYFIKSFSYYAVWIG 195

  Fly   197 INDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCV-FLYNGEMYDYPCHYTFRFIC 254
            :.      |..|......::|..|:||:|:...:...| |..:.:..|..|:|.|.|||
Zfish   196 LY------KTRSWSDQSNSSFSYWSSGQPNIAGSCTVVSFSDSWKWADENCNYAFPFIC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/112 (28%)
si:dkey-11o15.5XP_001337068.6 CLECT 19..136 CDD:321932 22/131 (17%)
CLECT 143..249 CDD:321932 31/114 (27%)
CLECT 257..374 CDD:321932
CLECT 381..498 CDD:321932
CLECT 509..624 CDD:321932
CLECT 633..739 CDD:321932
CLECT 746..863 CDD:321932
CLECT 870..996 CDD:321932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.