DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and illr2

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001121843.1 Gene:illr2 / 100147856 ZFINID:ZDB-GENE-050311-3 Length:253 Species:Danio rerio


Alignment Length:245 Identity:58/245 - (23%)
Similarity:94/245 - (38%) Gaps:71/245 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CGGFCLGVLTPVLNHLTISQ---NLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQ 98
            |..|.||.:..:...:..::   |::.|:....|.:     |..:..:..:|::::.        
Zfish    48 CLLFALGAVCTLAVFMARTETHFNVSVSDQEHNATD-----YKEQLDVLHIQHQEML-------- 99

  Fly    99 GRKLNVNEQNFTERLNCMEG-ILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASK 162
             :|||        |||...| .|.|:..|              ..|.|.||...| :.||:.:..
Zfish   100 -QKLN--------RLNESSGCALCAVHWT--------------HSGGKCYYFSTV-KMNWTQSRD 140

  Fly   163 TCRNMGGHLADI--KDEADLAAIKANLKEDTHYWLGINDLDHEGKFL---SMPTGKQTTFL---- 218
            .|...||||..|  |.|.|..|.|.::   || |:|:||:..||:::   :.|..|...|.    
Zfish   141 HCVTKGGHLVIITSKAEQDFLASKISV---TH-WIGLNDMHTEGRWVWVDNQPLNKSVEFWMKRV 201

  Fly   219 -------KWASGRPSQLD------TLNCVFLYNGEMYDYPCHYTFRFICQ 255
                   .|....|...|      :|.....:|.::    |..|.||:|:
Zfish   202 NGNNEPDNWTKNHPGGEDCACLGHSLGATEFWNDDL----CTATKRFVCE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 36/130 (28%)
illr2NP_001121843.1 CLECT_DC-SIGN_like 114..247 CDD:153060 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.