DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and si:dkey-61f9.1

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_017210940.1 Gene:si:dkey-61f9.1 / 100034385 ZFINID:ZDB-GENE-041210-13 Length:364 Species:Danio rerio


Alignment Length:284 Identity:60/284 - (21%)
Similarity:109/284 - (38%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLS 90
            ::|..  |||...|        .|....|.:.  .|||:|.|..:....||   .|..:.::|.:
Zfish     9 LLCAF--PPSAAEG--------RLRQFYIMKQ--RSNNTSAAQSLCRVNYT---DLVTIYDQQDN 58

  Fly    91 IEVA------------LDAQGRKLNVNEQN------------FTERLNCMEGILSALE-----KT 126
            |::.            :.|.....::...|            ::::..|     :||.     ::
Zfish    59 IKLQQLLNSSSFQQGWIGAYRGNYSLKWSNGDDVTYSRYSPSYSDQTRC-----AALNANGDWES 118

  Fly   127 VLEVKTKIKYLGFEQI---GSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKAN-L 187
            :|..:|| .::.:||.   |:.|.|:.....||||.|...||.....|..|::|.:...:|.| .
Zfish   119 ILCNETK-HFMCYEQDGDGGTTYNYLLIPQNKNWSDAQLYCRENHTDLVSIRNEEENTLVKNNGT 182

  Fly   188 KEDTHYWLG-IND---------LDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMY 242
            :.:|.:|:| :||         ..:...|......:...|::...||.::.|..|          
Zfish   183 QSNTAFWIGLLNDNVNWRDGGPSAYRNWFQEFEQSRPNAFMRLTDGRWTRADINN---------- 237

  Fly   243 DYP-CHYTFRFICQTE---EEDLN 262
            :|| |:.:|..:...|   |:.:|
Zfish   238 NYPLCYKSFIHVSPAEMSWEDAMN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 29/120 (24%)
si:dkey-61f9.1XP_017210940.1 CLECT 23..130 CDD:295302 19/117 (16%)
CLECT 140..244 CDD:295302 28/113 (25%)
CLECT 242..363 CDD:153057 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.