DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and si:dkey-83f18.11

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021333043.1 Gene:si:dkey-83f18.11 / 100003110 ZFINID:ZDB-GENE-070705-496 Length:524 Species:Danio rerio


Alignment Length:116 Identity:29/116 - (25%)
Similarity:55/116 - (47%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 EQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLK-EDTHYWLGINDLDHE 203
            |.:..:|::|.::  |.|:.|.:.||.....||.:.:..|:..:..::| .|...|:|:.     
Zfish   181 ECVQRQYHFINEM--KTWTEAQRYCREKYTDLATVDNMNDMIQLMKSVKVNDRGVWIGLQ----- 238

  Fly   204 GKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYTFRFIC 254
             :.....:|....||.|.:.:|...|  .|.|:.||:..|..|:.::.|:|
Zfish   239 -RKWQWSSGDPALFLHWGNEQPDGAD--ECAFMRNGQWEDGKCNDSWIFVC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 28/110 (25%)
si:dkey-83f18.11XP_021333043.1 CLECT 25..>68 CDD:321932
CLECT 66..>141 CDD:321932
CLECT_1 185..288 CDD:153072 28/112 (25%)
CLECT 291..403 CDD:321932
CLECT 409..521 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.