DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and zgc:172053

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001104712.1 Gene:zgc:172053 / 100002541 ZFINID:ZDB-GENE-080219-25 Length:151 Species:Danio rerio


Alignment Length:125 Identity:32/125 - (25%)
Similarity:62/125 - (49%) Gaps:14/125 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GFEQIGSKYYYIEKVSEK-NWSTASKTCRNMGGHLADIKDEAD----LAAIKANLKEDTHYWLGI 197
            |:.:.|.|.|..  :|:. .|:||.|.|:::|.:||.:..:|:    |:.|.::   .|..|:|.
Zfish    29 GWSKFGVKCYRF--ISQSVTWATAEKNCQSLGANLASVHSKAENDFLLSLIPSS---STRCWIGG 88

  Fly   198 NDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCV---FLYNGEMYDYPCHYTFRFIC 254
            :|.::||::| ...|....:..|.:..|:..:..||:   :..|....|..|..:..::|
Zfish    89 HDGENEGRWL-WTDGSVIDYNNWCATEPNNQNVENCMEMQWTVNRCWNDQACSTSMGYMC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 29/117 (25%)
zgc:172053NP_001104712.1 CLECT 26..147 CDD:214480 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.