DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42374 and Inip

DIOPT Version :9

Sequence 1:NP_001137972.1 Gene:CG42374 / 7354371 FlyBaseID:FBgn0259720 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001013595.1 Gene:Inip / 66209 MGIID:1913459 Length:104 Species:Mus musculus


Alignment Length:123 Identity:31/123 - (25%)
Similarity:48/123 - (39%) Gaps:38/123 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFPTTSAQQAETNRKILEEIQTKKQLLAGGIINLGLSPPNQMPAPQLLGQPTTVNPDFQAGVGIA 66
            |.|:....|.:....||.|:..:|:.|.                  :..|.:|.:|    |..|:
Mouse     3 ANPSGQGFQNKNRVAILAELDKEKRKLL------------------MQNQSSTSHP----GASIS 45

  Fly    67 TNATSTA----------------RSAFNPTSSTTLGFFIPQDSYFGNSFIPVLPRLEP 108
            .:..|..                ::|.....:.:.|:||.|||.|||..:||||||:|
Mouse    46 LSRPSLTKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42374NP_001137972.1 SOSSC 17..106 CDD:374228 25/104 (24%)
InipNP_001013595.1 SOSSC 18..101 CDD:318196 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008788
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109923
Panther 1 1.100 - - LDO PTHR31526
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.