DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42374 and Mettl5

DIOPT Version :9

Sequence 1:NP_001137972.1 Gene:CG42374 / 7354371 FlyBaseID:FBgn0259720 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001107653.1 Gene:Mettl5 / 502632 RGDID:1566062 Length:209 Species:Rattus norvegicus


Alignment Length:78 Identity:15/78 - (19%)
Similarity:29/78 - (37%) Gaps:22/78 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTTSAQQAETNRKILEEIQTKKQLLAG---GIINLGLSPPNQMPAPQLLGQPTTVNPDFQAGVGI 65
            |..:|....|.....::|::|.....|   |::::|.:         :||          ||:.:
  Rat    33 PHIAACMLYTIHNTYDDIESKAVADLGCGCGVLSIGAA---------MLG----------AGLCV 78

  Fly    66 ATNATSTARSAFN 78
            ..:....|...||
  Rat    79 GFDIDEDALEIFN 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42374NP_001137972.1 SOSSC 17..106 CDD:374228 12/65 (18%)
Mettl5NP_001107653.1 COG2263 7..209 CDD:225172 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2263
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.