DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42374 and inip

DIOPT Version :9

Sequence 1:NP_001137972.1 Gene:CG42374 / 7354371 FlyBaseID:FBgn0259720 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_956513.1 Gene:inip / 393188 ZFINID:ZDB-GENE-040426-961 Length:103 Species:Danio rerio


Alignment Length:112 Identity:38/112 - (33%)
Similarity:53/112 - (47%) Gaps:16/112 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFPTTSAQQAETNRKILEEIQTKKQLL--AGGIINLGLSPPNQMPAPQLLGQPTTVNPDF--QAG 62
            |.|.....|.:....||.|:..:|:.|  :..:.|.|.|.|...||         ||.:|  ||.
Zfish     3 ANPPGQGFQNKNRVAILAELDKEKRRLIQSQTLNNPGASIPLSRPA---------VNKEFRDQAE 58

  Fly    63 VGIATNATSTARSAFNPTSSTTLGFFIPQDSYFGNSFIPVLPRLEPL 109
               ..:..:..::|.....:.:.||||.|||.|||..:||||||:||
Zfish    59 ---QQHIAAQQKAALQHAHAHSSGFFITQDSSFGNLILPVLPRLDPL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42374NP_001137972.1 SOSSC 17..106 CDD:374228 31/92 (34%)
inipNP_956513.1 SOSSC 18..99 CDD:292547 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5483
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008788
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109923
Panther 1 1.100 - - LDO PTHR31526
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.