DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42374 and inip

DIOPT Version :9

Sequence 1:NP_001137972.1 Gene:CG42374 / 7354371 FlyBaseID:FBgn0259720 Length:129 Species:Drosophila melanogaster
Sequence 2:XP_002936734.1 Gene:inip / 100380060 XenbaseID:XB-GENE-988714 Length:128 Species:Xenopus tropicalis


Alignment Length:112 Identity:31/112 - (27%)
Similarity:49/112 - (43%) Gaps:22/112 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFPTTS-----AQQAETNRKILEEIQTKKQLLAGGIINLGLSPPNQMPAPQLLGQPTTVNPDFQ 60
            :.||..:     |:..:..||:|.:.||........|   .|:.||             :|.||:
 Frog    32 IGFPNKNRVAILAELDKEKRKLLLQNQTSTNNPGASI---ALTRPN-------------MNKDFR 80

  Fly    61 AGVGIATNATSTARSAFNPTSSTTLGFFIPQDSYFGNSFIPVLPRLE 107
            .... ..:..:..::|.....:.:.|:||.|||.|||..:||:||||
 Frog    81 DHAE-QQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVIPRLE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42374NP_001137972.1 SOSSC 17..106 CDD:374228 23/88 (26%)
inipXP_002936734.1 SOSSC 42..125 CDD:374228 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008788
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31526
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.