DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UCP3 and CG18327

DIOPT Version :9

Sequence 1:NP_003347.1 Gene:UCP3 / 7352 HGNCID:12519 Length:312 Species:Homo sapiens
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:294 Identity:82/294 - (27%)
Similarity:138/294 - (46%) Gaps:19/294 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    17 FLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGL 81
            |:..|.||..|.:.|.|::..|.|:|:||| .|.:.:....|:.|....:|:.:.:|......||
  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGE-LAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGL 69

Human    82 VAGLQRQMSFASIRIGLYDSVKQ---VYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVR 143
            ...|..|....|.|:.:|....:   |:..||  ..|....:..|...|.:...||.|..::|.:
  Fly    70 APALCFQFVINSFRLSIYTHAVEKGWVHNNKG--EISFAKGMFWGALGGVVGSYCASPFFLIKTQ 132

Human   144 FQA----SIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILK 204
            .||    .|.:|   ...:::...||.|.|.|:.||.|||:|:|.|:.|..:.:..::..:...|
  Fly   133 LQAQAAKQIAVG---YQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAK 194

Human   205 EKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMN-----SPPGQYFSP-LDCMIKM 263
            ..|.:..::|......|.|...||...::..:|:|||.||..|     ...|.|:.. |||::.:
  Fly   195 SLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTI 259

Human   264 VAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQL 297
            :..||....||||.|.:||...::.::.:.:::|
  Fly   260 LRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UCP3NP_003347.1 Mito_carr 10..110 CDD:278578 26/95 (27%)
Solcar 1 11..105 25/90 (28%)
PTZ00169 14..302 CDD:240302 82/294 (28%)
Mito_carr 112..210 CDD:278578 27/101 (27%)
Solcar 2 114..206 26/95 (27%)
Mito_carr 214..303 CDD:278578 27/90 (30%)
Solcar 3 215..300 26/89 (29%)
Purine nucleotide binding. /evidence=ECO:0000250 279..301 3/19 (16%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 24/81 (30%)
PTZ00169 5..293 CDD:240302 81/292 (28%)
Mito_carr 101..201 CDD:278578 28/104 (27%)
Mito_carr 204..296 CDD:278578 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.