DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UCP2 and Ucp4A

DIOPT Version :9

Sequence 1:XP_024304442.1 Gene:UCP2 / 7351 HGNCID:12518 Length:310 Species:Homo sapiens
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:280 Identity:97/280 - (34%)
Similarity:150/280 - (53%) Gaps:10/280 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    33 YPCSYPVLALQIQGESQGPVRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVR 97
            ||.......||||||........::.||||::.|...:.|.||...|:.|:...|.|.:.::.||
  Fly    59 YPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVR 123

Human    98 IGLYDSV-KQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQAR---AGGGRRYQ 158
            |..||.: |:|...|::...:....|.|.|.||:|..:|.|.|:|||:.|.:.|   .|...|..
  Fly   124 ICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVH 188

Human   159 STVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAF 223
            |..:|::.|.:..|.:|||||:.|||.|.|:||..:|.|||.||..::....|.|....|..::.
  Fly   189 SAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASV 253

Human   224 GAGFCTTVIASPVDVVKTRYMNSALGQ------YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLG 282
            .|||...::.:|.||||||.||....:      |..:..|....:.|||..|.||||:|.::|:.
  Fly   254 CAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMA 318

Human   283 SWNVVMFVTYEQLKRALMAA 302
            .|::..::::||:::.:.|:
  Fly   319 PWSLTFWLSFEQIRKMIGAS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 25/70 (36%)
Mito_carr 113..207 CDD:278578 38/96 (40%)
Mito_carr 218..300 CDD:278578 28/87 (32%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 96/275 (35%)
Mito_carr 39..138 CDD:278578 27/78 (35%)
Mito_carr 142..239 CDD:278578 38/96 (40%)
Mito_carr 248..336 CDD:278578 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.