DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UCP1 and CG1907

DIOPT Version :9

Sequence 1:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:294 Identity:87/294 - (29%)
Similarity:145/294 - (49%) Gaps:10/294 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    12 TLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYS 76
            |..::....|::...|.::..|||..|.|:|:.|  ..|....|:..|..|..:|..||.:.||.
  Fly    16 TNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISG--AGSGKKEYRSSLHCIQTIVSKEGPLALYQ 78

Human    77 GLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRL 141
            |:.|.|.||.:..:.|:|:|..:.:......:.:|.:...:..|...|....|||.|.||..||:
  Fly    79 GIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM 143

Human   142 QAQSHLHGIKPR-YTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKN 205
            .:...|...:.| ||...||...|...||||.||:|:.|.:.|::::|.|:|.:|...|..|...
  Fly   144 TSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHG 208

Human   206 NI-LADDVPCHLVSALIAGFCATAMSSPVDVVKTR-----FINSPPGQYKSVPNCAMKVFTNEGP 264
            .: :.:.:..|..:::::|...|..|.|:|:.|||     .::..| :|:...:..::|...||.
  Fly   209 PLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP-EYRGTADVLLRVARQEGV 272

Human   265 TAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSK 298
            .|.:||..|.:.|||...|:.|:..|||.:..:|
  Fly   273 FALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 27/91 (30%)
Solcar 1 11..102 27/89 (30%)
Mito_carr 111..206 CDD:278578 33/95 (35%)
Solcar 2 111..201 32/90 (36%)
Solcar 3 210..295 26/89 (29%)
Mito_carr 215..300 CDD:278578 27/89 (30%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 27/94 (29%)
Mito_carr 118..207 CDD:278578 32/88 (36%)
Mito_carr 219..307 CDD:278578 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.