DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UCP1 and CG18327

DIOPT Version :9

Sequence 1:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:284 Identity:75/284 - (26%)
Similarity:128/284 - (45%) Gaps:12/284 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    21 GIAACLADVITFPLDTAKVRLQVQGECPT--SSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQ 83
            |:||..|.|.|.|::..|.|:|:|||...  |....||.|......|.|.:|.:.|..||...|.
  Fly    10 GVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAPALC 74

Human    84 RQISSASLRIGLY-DTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHL 147
            .|....|.|:.:| ..|::......:...|....:..|...|.|..:...|..::|.:||||:..
  Fly    75 FQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQAQAAK 139

Human   148 H---GIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILA 209
            .   |.:.::....:|.|.|....|:.|||:|:..|:.|:.:.:..::..:...|....:|.::.
  Fly   140 QIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKENGVVT 204

Human   210 DDVPCHLVSALIAGFCATAMSSPVDVVKTRFIN---SPPGQ---YKSVPNCAMKVFTNEGPTAFF 268
            ........|.|.||...:...:|:|||.||..|   ...|:   |:...:|.:.:..:||....:
  Fly   205 HPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLY 269

Human   269 KGLVPSFLRLGSWNVIMFVCFEQL 292
            ||..|.:||...::.::.:.|::|
  Fly   270 KGFWPIYLRSAPYSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 29/85 (34%)
Solcar 1 11..102 29/83 (35%)
Mito_carr 111..206 CDD:278578 22/97 (23%)
Solcar 2 111..201 22/92 (24%)
Solcar 3 210..295 23/89 (26%)
Mito_carr 215..300 CDD:278578 23/84 (27%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 27/76 (36%)
PTZ00169 5..293 CDD:240302 74/282 (26%)
Mito_carr 101..201 CDD:278578 22/99 (22%)
Mito_carr 204..296 CDD:278578 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.