DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UPK1B and Tsp74F

DIOPT Version :9

Sequence 1:NP_008883.2 Gene:UPK1B / 7348 HGNCID:12578 Length:260 Species:Homo sapiens
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:265 Identity:53/265 - (20%)
Similarity:93/265 - (35%) Gaps:81/265 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    24 CCG-----IALTAECIFFVSDQ----HSLYPLLEATDNDDIY------GAAWIGIFVGICLFCLS 73
            |||     ....|..:.||...    .:|:.|::.:..:::.      ||.::.:...|.:..:|
  Fly     9 CCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVS 73

Human    74 VLGIVGIMKSSRKILLAYFILMFIVYAFEVASCITA-----ATQQDFFTPNLFLKQMLERYQNNS 133
            .||.||..|..:.:||.|||::.:|:...:...:..     ..||   |....::..:..|.:  
  Fly    74 FLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQ---TMRQEMRSTMALYGS-- 133

Human   134 PPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCC------- 191
                     ...:|:.||....:..||||:...||.:|.            |.|..||       
  Fly   134 ---------RREITQAWDLTQERLQCCGVDTWHDWNRYG------------PVPESCCQELFGGQ 177

Human   192 --------VMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRHAWGVAWFGFAILCWTFWVL 248
                    .:.||                 :||||..:.:..:..||   |..|...:.....::
  Fly   178 RKECTIFPTITNL-----------------YNQGCLYVTTNFIRDHA---AVIGGTSIAVAILMI 222

Human   249 LGTMF 253
            .|.:|
  Fly   223 FGMIF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UPK1BNP_008883.2 Tetraspannin 10..258 CDD:278750 53/265 (20%)
uroplakin_I_like_LEL 118..230 CDD:239409 21/126 (17%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 50/260 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.