DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UCHL3 and Uch

DIOPT Version :10

Sequence 1:XP_011533514.1 Gene:UCHL3 / 7347 HGNCID:12515 Length:294 Species:Homo sapiens
Sequence 2:NP_476940.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster


Alignment Length:53 Identity:14/53 - (26%)
Similarity:27/53 - (50%) Gaps:5/53 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    75 LALQHAGRNPSQKT-INKYWTPQTAKLNFDDFCIILRKEKPTSKAELLKSFKQ 126
            ||:.||.:.|...| :....||:..::|.|.:...|.::    :|::|...|:
  Fly   274 LAMHHALQMPGPATFLAGMQTPELVQINLDAYFEGLSEK----EADVLSYLKE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UCHL3XP_011533514.1 Peptidase_C12_UCH_L1_L3 6..291 CDD:187737 14/53 (26%)
UchNP_476940.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.