DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBTF and tHMG2

DIOPT Version :10

Sequence 1:NP_055048.1 Gene:UBTF / 7343 HGNCID:12511 Length:764 Species:Homo sapiens
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:108 Identity:30/108 - (27%)
Similarity:49/108 - (45%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   196 PEKPKTPQQLWY--THEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEE 258
            |:||.:...||.  |..|.:..: .||.:.:||....|:.|..::|:.::.|...|.:...||:|
  Fly     9 PKKPMSAFMLWMNSTGRKNIRAE-HPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKE 72

Human   259 IMRDYIQKHPELNISEEGITKSTLTKAERQLKDKF---DGRPT 298
                   |..:.|..:|..|:|.....|..|..:|   :.|||
  Fly    73 -------KLEKWNAFKEHQTESFPHIYEAPLSSRFSKTNQRPT 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBTFNP_055048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HMG-box_UBF1_rpt1-like 109..185 CDD:438814
HMG-box_UBF1_rpt2 196..270 CDD:438815 20/75 (27%)
HMG-box_UBF1_rpt3 297..379 CDD:438816 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..411
HMG-box_UBF1_rpt4 405..470 CDD:438817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..487
HMG_box_5 479..562 CDD:434287
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 546..576
HMG-box_UBF1_rpt6-like 565..650 CDD:438819
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 648..764
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.