DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE3A and CG3356

DIOPT Version :10

Sequence 1:NP_000453.2 Gene:UBE3A / 7337 HGNCID:12496 Length:875 Species:Homo sapiens
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:117 Identity:30/117 - (25%)
Similarity:40/117 - (34%) Gaps:43/117 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   375 AFTKSSQLFQHVRVHTGEKPYECKECGKA--FTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSA 437
            |.|:.|:.|       |:|.....|||.|  |....|       ||      | :|    :....
  Fly    14 ASTRGSKKF-------GDKCESTTECGFAGSFCDPKK-------HT------C-QC----TVDLP 53

Human   438 LTNHQRIHTGEKPYECKDCGKAFTQSSQLRQHQRIHAGE-----KPFECLEC 484
            .|||           ...|||..|:.::.|..:.|...|     ||...:||
  Fly    54 ATNH-----------IDKCGKTVTEQTECRDGRCICLFEMNPFFKPDGSVEC 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE3ANP_000453.2 AZUL 29..83 CDD:465173
HECTc 523..873 CDD:238033
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.