powered by:
Protein Alignment birc5l and Bruce
DIOPT Version :9
Sequence 1: | NP_001037948.1 |
Gene: | birc5l / 733575 |
XenbaseID: | XB-GENE-966741 |
Length: | 139 |
Species: | Xenopus tropicalis |
Sequence 2: | NP_001262460.1 |
Gene: | Bruce / 41260 |
FlyBaseID: | FBgn0266717 |
Length: | 4976 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 30/72 - (41%) |
Similarity: | 40/72 - (55%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Frog 11 ATRLSTFANWPFTEDCACTPERMAEAGFVHCPSDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKH 75
|.|..||..||..:.....|::||:|||.|.||.:..|...||.|...|..|:..|:|..||::|
Fly 249 AVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERH 313
Frog 76 SPSCLFI 82
||.|.|:
Fly 314 SPLCPFV 320
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1404665at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.