DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2N and Ubc2

DIOPT Version :9

Sequence 1:NP_003339.1 Gene:UBE2N / 7334 HGNCID:12492 Length:152 Species:Homo sapiens
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:143 Identity:66/143 - (46%)
Similarity:82/143 - (57%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR 70
            :||.||...:..:|.|...|.|...|...:...|.||..|.:|||.|.|::....|||...|||.
  Fly    89 KRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVT 153

Human    71 FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQ 135
            |.|:|||.|::..|.||||||||.|||||.|..|||||.:||:..||.|||...:|.|:..|..:
  Fly   154 FRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREE 218

Human   136 AIETARAWTRLYA 148
            ....||.||:.||
  Fly   219 HDRIARLWTKRYA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2NNP_003339.1 UBCc 4..151 CDD:412187 66/143 (46%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 64/141 (45%)
UQ_con 90..227 CDD:278603 62/136 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.