DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2L3 and eff

DIOPT Version :10

Sequence 1:NP_001243284.1 Gene:UBE2L3 / 7332 HGNCID:12488 Length:212 Species:Homo sapiens
Sequence 2:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster


Alignment Length:118 Identity:51/118 - (43%)
Similarity:78/118 - (66%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    89 NLLTWQGLIV-PDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAEN 152
            :|..||..|: |.:.||..|.|.:.|:||.:|||||||:.|.|:||||||:..|.:||.::.:: 
  Fly    29 DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQ- 92

Human   153 WKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 205
            |.||....:|:.|:.:|:.||.|:.||..::|..|..||:|:.:.|.|:|:||
  Fly    93 WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2L3NP_001243284.1 UBCc_UBE2L3 68..207 CDD:467421 51/118 (43%)
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 49/116 (42%)

Return to query results.
Submit another query.