DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2L3 and CG17030

DIOPT Version :9

Sequence 1:NP_001243284.1 Gene:UBE2L3 / 7332 HGNCID:12488 Length:212 Species:Homo sapiens
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:133 Identity:65/133 - (48%)
Similarity:97/133 - (72%) Gaps:0/133 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    80 FRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVC 144
            |||:.|:..|:..|.||::|..|||||||:::||:||.:||||||:|...|::||.|::|:||||
  Fly    31 FRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVC 95

Human   145 LPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 209
            :|::..|:|.|.|:.|||:|.|:|.:||||||:....::|.||..|..:|.|.|:.:.:||.|.|
  Fly    96 VPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMADAWVQKYSEPR 160

Human   210 PVD 212
            |.:
  Fly   161 PTE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2L3NP_001243284.1 COG5078 67..208 CDD:227410 62/127 (49%)
UBCc 67..207 CDD:214562 62/126 (49%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 62/126 (49%)
UQ_con 14..153 CDD:278603 60/121 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.