DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2L3 and morgue

DIOPT Version :10

Sequence 1:NP_001243284.1 Gene:UBE2L3 / 7332 HGNCID:12488 Length:212 Species:Homo sapiens
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:148 Identity:48/148 - (32%)
Similarity:68/148 - (45%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    77 MKNFRNIQVDEANLLT------------------WQGLIV-PDNPPYDKGAFRIEINFPAEYPFK 122
            |:|  |....|||||.                  ||..|: |...||:.|.|.:.|.||..||..
  Fly   337 MRN--NFLRGEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMT 399

Human   123 PPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEY 187
            ||.:.|.|||.|||:...|.|.:.:....||..|....:|:.|:.:|:.||..|..:..:|...|
  Fly   400 PPTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIY 464

Human   188 SKDRKKFCKNAEEFTKKY 205
            ..:|::|.:....:|.||
  Fly   465 EHERERFEQLVRAWTWKY 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2L3NP_001243284.1 UBCc_UBE2L3 68..207 CDD:467421 48/148 (32%)
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 48/148 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.