DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2H and CG14739

DIOPT Version :9

Sequence 1:NP_003335.1 Gene:UBE2H / 7328 HGNCID:12484 Length:183 Species:Homo sapiens
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:180 Identity:75/180 - (41%)
Similarity:106/180 - (58%) Gaps:4/180 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     4 PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSI 68
            |..| ||:|.||.:|:.|.:..|:...:....|...||.|:.||||:|.|.|.:|..||..:|.:
  Fly    12 PMAG-RRLDRDVNRLLASGYRTTVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRV 75

Human    69 GFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHR 133
            .|:.||.||||:..:|.||::|:.|.|::.|||.||||:||||||.||||.|.||..|||:..|.
  Fly    76 RFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHS 140

Human   134 PEEYKQKIKEYIQKYATEEALKEQ---EEGTGDSSSESSMSDFSEDEAQD 180
            .:.:::.:...::.||....|..:   |||....||:.|:||...|...|
  Fly   141 EQLFREHVILCMKTYAMPANLPTRQLVEEGLEKRSSDLSLSDLLTDSDDD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2HNP_003335.1 UQ_con 31..145 CDD:395127 52/113 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..183 11/32 (34%)
CG14739NP_650151.1 COG5078 12..157 CDD:227410 63/145 (43%)
UQ_con 17..152 CDD:278603 59/134 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0416
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S325
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301162at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.