DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2E2 and CG10862

DIOPT Version :9

Sequence 1:NP_001357154.1 Gene:UBE2E2 / 7325 HGNCID:12478 Length:201 Species:Homo sapiens
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:142 Identity:74/142 - (52%)
Similarity:98/142 - (69%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    59 RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTF 123
            |:::|::|.:.|....|.|...|||::.|.:||.||..:|||||.|.::|.|..:|||.||.:.|
  Fly   212 RLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAF 276

Human   124 RTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH 188
            .|:.|||||...|.||||||...|||||::||||:||.|||.|.||.||:..|:|..:..|||.|
  Fly   277 LTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALH 341

Human   189 DRMARQWTKRYA 200
            |:.||:|||:||
  Fly   342 DKNAREWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2E2NP_001357154.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
UQ_con 59..196 CDD:395127 69/136 (51%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 74/142 (52%)
UQ_con 212..349 CDD:278603 69/136 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.