DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2E2 and CG2574

DIOPT Version :9

Sequence 1:NP_001357154.1 Gene:UBE2E2 / 7325 HGNCID:12478 Length:201 Species:Homo sapiens
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:184 Identity:87/184 - (47%)
Similarity:115/184 - (62%) Gaps:10/184 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    27 VQQEPE----------REQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKG 81
            |:.|||          .|:..|..........|.|.|:....||:.||.:|..:|||||:|....
  Fly    24 VEVEPEVLSRASVASSVEETAPSTSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPPNCTADLHH 88

Human    82 DNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN 146
            .::..|.:.:.||.|||||||.|.|||.|...|||:.|::.|.|||||||::|:|.||||:|.:.
  Fly    89 GDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAICLDVLGER 153

Human   147 WSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200
            |||.:.::||||||..|:::|||.||||..||.||.|||.|||::||.|||.:|
  Fly   154 WSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHWTKLFA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2E2NP_001357154.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 9/37 (24%)
UQ_con 59..196 CDD:395127 74/136 (54%)
CG2574NP_572796.1 COG5078 66..208 CDD:227410 78/142 (55%)
UQ_con 66..203 CDD:278603 74/136 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.