DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2E2 and CG2574

DIOPT Version :10

Sequence 1:NP_689866.1 Gene:UBE2E2 / 7325 HGNCID:12478 Length:201 Species:Homo sapiens
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:184 Identity:87/184 - (47%)
Similarity:115/184 - (62%) Gaps:10/184 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    27 VQQEPE----------REQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKG 81
            |:.|||          .|:..|..........|.|.|:....||:.||.:|..:|||||:|....
  Fly    24 VEVEPEVLSRASVASSVEETAPSTSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPPNCTADLHH 88

Human    82 DNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN 146
            .::..|.:.:.||.|||||||.|.|||.|...|||:.|::.|.|||||||::|:|.||||:|.:.
  Fly    89 GDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAICLDVLGER 153

Human   147 WSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200
            |||.:.::||||||..|:::|||.||||..||.||.|||.|||::||.|||.:|
  Fly   154 WSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHWTKLFA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2E2NP_689866.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 9/37 (24%)
UBCc_UBE2E 58..198 CDD:467413 76/139 (55%)
CG2574NP_572796.1 UBCc_UEV 66..204 CDD:483950 75/137 (55%)

Return to query results.
Submit another query.